PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016501190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family B3
Protein Properties Length: 375aa    MW: 43796.4 Da    PI: 4.9449
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016501190.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3567.4e-181197195
                    EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95
                    ffk + p++  +s+ l +p  f+ e+ +gk   +k ++l+d+ g++W ++l   kk++  ++++GW +F ++n L+ gDf++F +dg+  f   +k
  XP_016501190.1 11 FFKFFYPEN--SSQKLKIPTAFT-EYkNGK--LPKRISLRDRFGNVWPIEL--AKKGRDLYFQDGWVKFIEDNSLEFGDFLIFDYDGSGVF--DFK 97
                    677775544..44559******9.563555..8889***************..********************************997666..444 PP

2B332.41.7e-102783541089
                     HHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3  10 vlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     + ++++l++p + +++++++   + ++ ++d++gr++e +++++k + r++l+kGW++ ++ n ++  D ++ ++++ + 
  XP_016501190.1 278 AKRRDQLYVPVDVVRDYNLE--LPPKMFFRDSEGRKFETEVNIWKDG-RIWLKKGWRKICRWNLVEKEDRCICEFMRGKA 354
                     567899***********776..6679***************999985.89********************9999876533 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.6E-207103IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.3399102IPR003340B3 DNA binding domain
SuperFamilySSF1019363.92E-2110104IPR015300DNA-binding pseudobarrel domain
CDDcd100175.78E-131199No hitNo description
SMARTSM010191.2E-1411102IPR003340B3 DNA binding domain
PfamPF023629.0E-161194IPR003340B3 DNA binding domain
SuperFamilySSF1019363.92E-16265360IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.3E-16265360IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS508639.277269366IPR003340B3 DNA binding domain
CDDcd100173.22E-7270362No hitNo description
SMARTSM010190.0018272363IPR003340B3 DNA binding domain
PfamPF023621.1E-8279352IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MDDAKKMEKG FFKFFYPENS SQKLKIPTAF TEYKNGKLPK RISLRDRFGN VWPIELAKKG  60
RDLYFQDGWV KFIEDNSLEF GDFLIFDYDG SGVFDFKLLG KTACEKKGAG VAVKVEEEEM  120
INIAHRKSEK PKGKKYLASD SISSSSSSYG DEDEEYMVEE EQEDEEEEYE EETNGKAIVI  180
CKKKAPCSKG SYVEEEKEDD DEDEEEEYEE DEEETEEEEK NNEKARMLKK KALCSKGVFK  240
RATTIKRRDV PDQYGAEIFR SGRATQPKNP YFVAKIRAKR RDQLYVPVDV VRDYNLELPP  300
KMFFRDSEGR KFETEVNIWK DGRIWLKKGW RKICRWNLVE KEDRCICEFM RGKANEVLYL  360
QVTLVKAGGV SNPVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1yel_A1e-1241044104At1g16640
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009613231.10.0PREDICTED: B3 domain-containing protein At5g60140-like isoform X1
RefseqXP_016501190.10.0PREDICTED: B3 domain-containing protein At5g60140-like
TrEMBLM1AQ141e-117M1AQ14_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000276731e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10912264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66980.12e-17B3 family protein